<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VN-39 VN-39 Vietnam 2005 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, T69S, K122E, D123S, S162C, K173I, Q174K, D177E, I178M, Q207A, R211S, W212*, V245E  
>VN-39| codons 6-248
DTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPVFAIKK
KDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFR
KYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMVIYQYMD
DLYVGSDLEIGQHRTKIEELRAHLLS*GFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIE
LPE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, L63C, H69K, L89M  
>VN-39| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Trinh, QD Short communication: Drug resistance mutations in the HIV type 1 protease and reverse transcriptase genes in antiretroviral-naive Vietnamese children. ARHR, 2012