<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VN-107 VN-107 Vietnam 2005 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   G16A, K20R, E35D, M36I, N37D, H69K, K70R, L89M, I93L  
>VN-107| codons 1-99
PQITLWQRPLVTIKIAGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Trinh, QD Short communication: Drug resistance mutations in the HIV type 1 protease and reverse transcriptase genes in antiretroviral-naive Vietnamese children. ARHR, 2012