<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5075 CA21456 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 91
2 AZT+DDC 61
3 3TC+AZT 26
4 3TC+D4T+NVP 13
5 3TC+NFV+NVP 74
6 3TC+AZT+NFV+NVP 112

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I13V, K20T, E35DN, M36I, N37S, R57K, I62V, L63P, I64V, T74S, I93L  
>CA21456| codons 1-99
PQITLWQRPVVTVKIGGQLTEALLDTGADDTVLEDISLPGRWKPKMIGGIGGFIKVKQYD
QVPVEICGHKAIGSVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   Y188L   K43KQ, E44D, K64R, K102E, V111I, K166R, V189I, G196GE, H208Y, R211K, K223KQ, V245E, T296S, E297K  
>CA21239| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIRKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKEKKSVTVLDIGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLLIGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLSKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005