<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8457 CA21445 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDC+IDV 83
2 D4T+DDC+NFV 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   Q18QH, K20T, E35D, M36I, R57K, I62V, A71V, T74TS  
>CA21445| codons 1-99
PQITLWQRPLVTIKIGGHLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVLIEICGHKVIGSVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11KR, K20KR, K102M, K126KR, R211K, K281KR, T286A, E291D, E297K K275KT
>CA21228| codons 1-298
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMKKSVTVLDVGDAYFSVPL
DKDFRRYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGITVKQLCRLLRGAKALTDVIPLTKE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005