<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4504 CA21444 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 73
2 3TC+AZT+IDV 60
3 3TC+D4T+NFV 21
4 D4T+DDI+IDV 76
5 D4T+DDI+IDV+RTV 92

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84IV, L90LM Q58E, N88G, L89V L10I, I13V, N37H, I62V, L63P, A71V, I72V, V77I, I93L  
>CA21444| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKIIGGIGGFIKVREYD
QVPIEICGHKVVGTVLIGPTPVNVIGRGVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F       E169D, D177E, Q207E, H208HY, L210LF, R211K, V245VE, A272P, I293V  
>CA21227| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREYLFKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005