<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6805 CA21436 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 7
2 NFV 21
3 D4T+ NFV 29
4 DDI+ D4T+ NFV 103
5 DDI+ D4T+ SQV 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54IL, L90LM N88D I13V, K20R, E35D, M36I, N37E, R57K, L63P, A71T, I93L  
>CA21436| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADNTVLEDIELPGRWKPKMIGGIGGFLKVKQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  D67G     V35L, R83K, D123E, I135V, D177E, I195IM, R211K, I293V  
>CA21219| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEMGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003