<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI+RTI 43
2 PI+RAL+RTI 135

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
Y143R T97A E11D, E13X, K14R, S24D, L28I, S39C, K42KR, L74I, S119P, Q164K, R187K, V201I, D232E, L234I  
>BR11SP363B| codons 1-288
FLDGIDKAQEDHXRYHSNWRAMADDFNIPPVVAKEIVACCDRCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQEAAYFLLKLAGRWPVKTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPRNPQSQGVVESMNKELKKIIGKVRDQAEHLKTAVQMAV
FIHNFKKKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSREPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Souza Cavalcanti, J In-vivo selection of the mutation F121Y in a patient failing raltegravir containing salvage regimen Antiviral Res, 2012