<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1580 CA21423 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 57
2 AZT+DDC 78
3 3TC+D4T 48
4 3TC+AZT+IDV 74
5 D4T+NFV+NVP 22
6 DDI+EFV+RTV+SQV 150

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA   E35ED, N37NS, R41K, Q61QE, I62V, L63P, T74S, I93L  
>CA21423| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
EVPIEICGHKAIGSVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, G190GA   E6ED, D123E, I135IV, S162C, R211K, T215X, A272P, T286A, I293V, P294PT  
>CA21205| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVTLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005