<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6832 CA21417 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ AZT 128
2 DDI+ D4T+ APV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, L90M L10F, L33F, N88D I13IV, K45R, Q61E, L63P, V77I, I93L  
>CA21417| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADNTVFEEMNLPGRWKPRMIGGIGGFLKVRQYD
EIPIEICGHKAIGTVLIGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     K43Q, K64KN, T69N, S162A, I178M, T200A, E203K, Q207E, K277R, I293V  
>CA21200| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEQEGKISKIGPENPYNTPV
FAINKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRAKIKELREHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005