<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8413 CA21396 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV+SQV 166

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84V, L90M L33F, F53FL, N88D I13V, I15V, K20KR, M36L, N37T, I62V, L63P, I66X, A71T, I72V, T74K  
>CA21396| codons 12-99
TVKVGGQLREALLDTGADDTVFEELTLPGRWKPKIIGGIGGLIKVRQYDQVPIEXCGHKT
VGKVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       V35I, T39A, K43E, S68G, V118I, K122E, I135AT, N136X, D177E, E203D, Q207E, R211K, A272P, K277R, T286TA, E297K A129AV, N137T, R143RT
>CA21178| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTVFTIPSAXTETPGITYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIDELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009