<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8422 CA21391 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 50
2 3TC+AZT+LPV+Unknown 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M   L10I, T12D, Q18QH, L19I, K20I, R41K, K55R, L63P, I64V, I66F, C67L, K70R, A71V, I72L, Q92K  
>CA21391| codons 1-99
PQITLWQRPIVDIKIGGHIIEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYD
QIPVEFLGHRVLGTVLVGPTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     K20R, K43KQ, T69N, K104N, K122E, I135T, K166R, I202V, R211K, A272P, K277R E302D
>CA21174| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LD

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006