<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4501 CA21380 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+ DDC 74
3 AZT+ 3TC 21
4 3TC+ AZT+ RTV 13
5 3TC+ AZT+ IDV 43
6 DDI+ DLV+ NFV 156
7 APV+ RTV+ ABC+ D4T 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, K20R, E35D, M36I, N37D, R41K, I62V, L63P, T74S, I93L, C95F  
>CA21380| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKAIGSVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q K103N   K122E, I135T, I202V, D218DE, A272P, K277R, E297Q  
>CA21162| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTQEAE
LE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005