<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179VE V60I, V118I, D123N, I135V, T139K, S162A, T165I, K173T, Q174K, D177E, I178V, D192DE, T200A, Q207E, F214L, L228LF L210LI
>38odyssee| codons 40-235
EMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSIPLDKNFRKYTAFTIPSVNNEKPGIRYQYNVLPQGWKGSPAI
FQASMIKILEPFRTKNPEVEIYQYMDDLYVGSELEIGQHRAKIEELREHLIRWGLTTPDK
KHQKEPPFFWMGYELH

References
Author Title Citation
Descamps, D Increasing prevalence of transmitted drug resistance mutations and non-B subtype circulation in antiretroviral-naive chronically HIV-infected patients from 2001 to 2006/2007 in France J Antimicrob Chemother, 2010