<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1498 CA21374 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 61
2 AZT 44
3 3TC+AZT+SQV 82
4 3TC+AZT 6
5 3TC+AZT+IDV 42
6 D4T+NFV+NVP 38
7 3TC+DDI+SQV 102

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L90M L23LI, G73S L10I, I13V, I62IV, L63P, A71V, I72L, V77I  
>CA21374| codons 1-99
PQITLWQRPIVTVKIGGQLKEAILDTGADDTVLEEMNLPGRWKPKMIGGIGGFLKVRQYD
QVPIEICGHKVLSTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, L74LV, M184V, L210W, T215Y K219E Y181C   E28A, K122E, S162C, E169D, Q197E, Q207E, R211K, A272P, K277R, T286A, A288AS, E297T  
>CA21156| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
CQYVDDLYVGSDLEIGEHRTKIEELREHLWKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTEVIPLTTEAE
LE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005