<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6800 CA21370 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 170
2 AZT+DDI 56
3 3TC+AZT 22
4 3TC+AZT+SQV 4
5 3TC+AZT+RTV 65
6 D4T+DDI+NVP 39
7 DDC+RTV+SQV 39
8 3TC+ABC+EFV+RTV+SQV 17
9 APV+D4T+DDI 44
10 3TC+ABC+IDV+RTV 39
11 ABC+DDI+LPV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V L33F, N83D T4P, L10V, K20R, E35N, M36I, N37T, F53I, R57K, I62V, L63P, T74A, I85V, L89I  
>CA21370| codons 1-99
PQIPLWQRPVVTIKIGGQLREALLDTGADDTVFENITLPGRWKPKLIGGIGGIIKVKQYD
QVPIEICGHKAIGAVLVGPTPVDVVGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, Y115F, Q151M, M184V, T215F A62V, V75I, K219Q K103N, Y188L   K20R, I31R, T39A, A98S, V118I, K122E, R172K, V179I, I202V, F214L, L228H, V245E, T286A, V292I  
>CA21152| codons 1-298
PISPIETVPVKLKPGMDGPRVKQWPLTEEKRKALVEICAELEKEGKISKIGPENPYNTPV
FVIKKKNSDKWRKLIDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAFFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIII
YQYVDDLLVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIIPLTEE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005