<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
11117952 11117952 Philippines 2011 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F K20R, E35D, M36I, R41K, Q61D, L63S, C67S, H69K, I72T, L89M, I93L  
>11117952| codons 1-99
PQITLWQRPFVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
DISIEISGKKATGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, K43E, K102R, K122E, D123S, S162C, E169K, K173I, Q174K, D177E, V179I, E194D, I195L, T200A, E203D, Q207A, R211S, V245E  
>11117952| codons 1-284
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILKPFRIKNPEIII
YQYMDDLYVGSDLDLGQHRAKIDELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLR

References
Author Title Citation
Telan, EF Possible HIV transmission modes among at-risk groups at an early epidemic stage in the Philippines. J Med Virol, 2013