<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35I, E36A, T39K, K43E, V111I, K122E, D123S, S162C, K173I, Q174K, D177E, I178M, V179I, T200A, Q207A, L210M, R211S, K238R, V245E  
>11052748| codons 1-284
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLMSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, M36I, N37D, L63P, H69K, L89M, I93L  
>11052748| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Telan, EF Possible HIV transmission modes among at-risk groups at an early epidemic stage in the Philippines. J Med Virol, 2013