<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5257 CA21353 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 3TC+AZT+IDV 70
3 D4T+RTV 22
4 D4T+DDI+NVP 26
5 3TC+D4T+DDI+NFV 48
6 ABC+APV 26
7 D4T+DDI+EFV+IDV+RTV 69

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, K43T L10IV, E35D, M36I, D60DE, I62IV, L63P, I64V, T74TS  
>CA21353| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEDINLPGRWTPKLIGGIGGFVKVRQYE
QVPVEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   L100I, K103N   V35I, E44D, K122E, I135T, E169D, E203K, Q207E, R211K, T286A, I293V  
>CA21126| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIKELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005