<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4305 CA21351 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 218
2 3TC+AZT 22
3 3TC+AZT+RTV 61
4 3TC+AZT+NVP 48
5 D4T+DDC+NFV 48
6 3TC+D4T+EFV+IDV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A N88D I15V, E35D, M36I, N37D, L63P, I64IV, A71AV, V75I  
>CA21351| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKVIGTILVGPTPANIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SG, M184IV A62V Y181C, G190A K101HQ E6K, K64R, K103KR, K122E, I135V, Y144F, E204D, H221Y, I293V, E297K  
>CA21130| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIRKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRFQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYIDDLYVASDLEIGQHRTKIEDLRQHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005