<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA799 CA21348 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 261
2 DDI 65
3 AZT+DDI 52
4 3TC+AZT 48
5 D4T+DDC+RTV 31
6 D4T+DDC+IDV 13
7 3TC+AZT+RTV+SQV 13
8 D4T+NFV+NVP 9
9 3TC+AZT+D4T+IDV 14
10 3TC+AZT+DDI+RTV+SQV 27
11 3TC+AZT+IDV+RTV 8
12 3TC+ABC+AZT+Unknown 39
13 ABC+LPV+TDF 53
14 ABC+APV+LPV+TDF 42
15 None 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, G73S, L89LV L10I, I15V, K20V, L24F, E35DN, M36I, R57K, I62V, L63P, A71V, I72M  
>CA21348| codons 1-99
PQITLWQRPIVTIKVGGQLVEALFDTGADDTVFEDINLPGRWKPKMIGGIGGFVKVKQYD
QVPIEICGHKVMSTVLVGPTPANIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y D67E, V75M K103KNRS, Y181I A98G S3C, V35M, K43Q, E44D, S68G, K122E, I135T, Q174QK, D177E, V179I, G196E, E203K, Q207E, R211RK, H221Y, V245VM, D250DE, A267X N136NI
>CA21123| codons 1-271
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEQDGKISKIGPENPYNTPV
FAIKKKEGTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKSKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTINETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEIII
IQYVDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWXSQIY

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005