<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1436 CA21346 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 NFV+ 3TC+ AZT 13
3 NVP+ NFV+ 3TC+ AZT 44
4 IDV+ 3TC+ AZT+ NVP 76

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, L90LM N88D K20I, D60DE, L63P, A71T, I72IT, V77I, I85IV, I93L  
>CA21346| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
QIPIEICGHKTTGTVLIGPTPVNIVGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   Y181C A98G K20R, E44D, K101KR, V118VI, K122E, G196E, E203EK, Q207E, R211K, V245T, D250E, A272P, K277R, T286A, E297R  
>CA21137| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLRKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTREAE

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005