<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8384 CA21331 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+IDV+NVP 82
2 D4T+DDI+IDV+RTV 89

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S, L90M Q58E L10I, I15V, K20T, E35D, M36I, I62V, L63P, A71T, I85IV  
>CA21331| codons 1-99
PQITLWQRPIVTIKVGGQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVREYD
QVPIEICGHKTIGTVLVGPTPVNIVGRSLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67G, K219E Y181C   V35M, K49R, S68G, D121H, K122E, D123S, I135T, Q174R, P176T, I178M, T200A, R211K, D218E, V245Q, L260I, K277R  
>CA21113| codons 1-283
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISRIGPENPYNTPV
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNTDMVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFFTPEEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKIVGKLNWASQIYAGIKVRQLCKLL

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009