<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, T39E, S48T, K122E, D123S, K173T, Q174K, I178L, T200E, Q207A, R211K, V245Q, E248D, A272P, K277R, Q278H, T286A, E291D, V292I, I293V, I329L, Q334D, R356K, G359T, T377M, K390R, E404D, V435L, A446S, L452A, S468T, D471E, T477S, H483Q, L491P, S519N, K530R, V531I, A534S, A554S E194T
>10ZA.48| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDLVI
YQYMDDLYVGSDLTIGQHREKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGDGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPILGAETFYVDGASNRETKAGKAGYVTDRGRQKVVTLTETTNQKSELQ
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERIYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Brehm, JH Frequent emergence of N348I in HIV-1 subtype C reverse transcriptase with failure of initial therapy reduces susceptibility to reverse-transcriptase inhibitors. Clin Infect Dis, 2012