<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4420 CA21303 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 65
2 D4T+ 3TC+ NFV 47
3 ADV+ NVP+ IDV 13
4 ADV+ ABC+ IDV+ NVP 30
5 NVP+ IDV+ ABC 25
6 ABC+ IDV+ RTV 8
7 ABC+ APV+ RTV+ D4T 52
8 3TC+ D4T+ ABC+ LPV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M Q58E, G73S, L89V L10I, I13V, I15IV, K20T, M36I, I62IV, L63P, H69Y, A71V, I72E, V77I, V82I, I93L  
>CA21303| codons 1-99
PQITLWQRPIVTVKVGGQLTEALLDTGADDTILEEINLPGRWKPKIVGGIGGFMKVREYD
QVPIEICGYKVESTVLIGPTPINIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y V75M, F77FL     E28K, K43E, E44A, K104R, V118I, K122E, G196E, E203V, Q207E, H208Y, R211K, R284K, I293V, E297A  
>CA21075| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIVELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTAEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005