<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8343 CA21262 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 70
2 AZT+DDC 26
3 3TC+AZT 22
4 3TC+AZT+IDV 96
5 D4T+DDI+IDV 148

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M N88D L10I, I13V, K14R, I15V, Q18H, N37E, I62V, L63P, C67F, A71AT, V77I, I93L, C95F T74R
>CA21262| codons 1-99
PQITLWQRPIVTVRVGGHLKEALLDTGADDTVLEEMELPGRWKPKIIGGIGGFIKVRQYD
QVPIEIFGHKTIGRVLIGPTPVNVIGRDLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210LW, T215Y       V35T, K49R, V60I, K122E, I135T, Q207QE, R211K, A288S, I293IV, E297A  
>CA21046| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISRIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009