<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8341 CA21259 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 D4T+DDI+NFV 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90LM L10F, T74P K55KR, D60E, I62IV, L63P  
>CA21259| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVRQYE
QVPIEICGHKAIGPVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       V35X, K43KQ, E44ED, V118I, K122E, D123N, S162C, I178L, T200TA, E203K, Q207E, K223Q, A272P, T286A, I293V, E297A  
>CA21043| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALXEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRAKIKELREHLWRWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005