<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8339 CA21257 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 104
2 3TC+D4T+NFV 211

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88ND I13IV, I15V, N37C, R41K, I62V, L63P, V75I, V77I, I93L  
>CA21257| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADNTVLEEMCLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTILIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y       I50IV, V60I, V118VI, K122E, I135L, I142T, K166KR, T200TK, Q207E, R211RK, V245E, S251I, K277R, I293V  
>CA21041| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKVGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRKKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDIWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005