<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5939 CA21254 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 D4T+RTV+SQV 47
3 ABC+DDI+EFV+NFV 49
4 ABC+D4T+EFV+3TC 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, K20R, E35D, M36I, N37E, R41K, I62V, L63P, A71T, I93L  
>CA21254| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIELPGKWKPKLIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y K219N K101DE, Y181C, G190S   T39A, Q174QR, T200A, E204EK, H208HY, R211RK, D237E, A272P, V276VA, V292VI, I293V, E297A L282L*
>CA21036| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
CQYMDDLYVSSDLEIGQHRAKIEKLRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKAKQLCK*LRGTKALTEIVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005