<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
08R_01-357 08R_01-357 Philippines 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, K45R, L63I, H69K, L89M, I93L  
>08R_01-357| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, K32E, V35T, E36A, T39E, S48T, K122E, K173G, Q174K, D177E, T200A, I202V, Q207E, R211K, V245Q, A272P, K277R  
>08R_01-357| codons 1-284
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRGKNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLR

References
Author Title Citation
Telan, EF The early phase of an HIV epidemic in a population exposed previously to HCV in the Philippines. J Med Virol, 2011