<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8468 CA21241 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 175

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV     A98AS, K122E, I132IV, E138A, G196E, Q207D, D250E, K277R, T286A, P294Q, E297R A288Q
>CA21241| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTVPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKQLTEVIQLTREAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   I15IV, K20KM, E35D, M36IV, R41K, I62V, L63HQ, A71V, I72T, I93L  
>CA21458| codons 1-99
PQITLWQRPLVTIKVGGQLMEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVHIEICGHKVTGTVLVGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009