<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8429 CA21185 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 3TC+AZT 152
3 D4T+DDI+NVP 101

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69DN, K70R, Q151M K219E Y181C   K20KR, A98S, K122KE, I135L, S162C, I178M, V179VI, R211A, F214L, L228LH, V245E, A272P, R284K, T286A, I293V, P294S  
>CA21185| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPDMII
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLAWGLTTPDEKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVVSLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K14KR, I15IV, R41K, L63P, H69Q, I72V, V77I, I93L  
>CA21403| codons 1-99
PQITLWQRPIVTIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009