<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8423 CA21176 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC 56
2 D4T+DDI+EFV 110

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, L74V D67G, K219N G190E   V60I, S68G, I135V, E138A, K173E, I178M, R211A, V245E, E248D, D250E, A272P, T286A  
>CA21176| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKGGTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDMVI
YQYMDDLYVESDLEIGQHRTKIEELRQHLLAWGFTTPDNKHQKEPPFLWMGYELHPDKWT
VQPIELPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, N37DE, L63P, A71T, V77I, I93L  
>CA21393| codons 14-99
KIGGQIKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKTIG
TVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012