<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5423 CA21147 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 61
2 D4T+DDC 57
3 3TC+D4T+SQV 17
4 3TC+D4T+RTV 61
5 D4T+NVP+SQV 78
6 3TC+D4T+RTV 39
7 ABC+EFV+IDV+RTV 17
8 None 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C, G190GA   K11X, W88C, D121H, K122E, I135T, D177E, H208HY, R211RK, H221Y, V245E, I257IV, A272P, A288G, E291D, E297K V254VI
>CA21147| codons 1-300
PISPIETVPVXLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVASDLEIGQHRTKIEELRQYLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTINDVQKLVGKLNWASQIYPGIKVKQLCKLLRGTKGLTDVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, D60E, L63P  
>CA21367| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005