<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8399 CA21136 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 13
2 None 26
3 D4T+DDI 126
4 AZT+EFV+NVP 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, V106VA   V35I, R83K, K104R, K173N, Q174K, I178L, V179I, R211K, D218E, V241VA, S268SC, A272P, K281R  
>CA21136| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNRSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNKNPDLII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPEKKHQKEPPFLWMGYELHPDKWT
AQPIVLPEKDSWTVNDIQKLVGKLNWACQIYPGIKVKQLCRLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, I15V, Q18QH, E35D, R41K, R57K, L63P R8RQ
>CA21345| codons 1-99
PQITLWQRPLVSIKVGGHLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005