<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8381 CA21110 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 208
2 3TC+ D4T 104
3 3TC+ D4T+ RTV 8
4 3TC+ D4T+ SQV 104
5 APV+ 3TC+ NVP 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, L74I, M184V, L210W, T215F K219Q Y181C, G190A   T39E, V60I, K122E, I135T, V179I, H208Y, R211K, D218E, L228H, V245T, A272P, E297K  
>CA21110| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVASDLEIGQHRTKIEELRQYLWKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, L90M L10F I13V, K20I, M36MI, I64V, T74S, V77I, I85IV  
>CA21328| codons 1-99
PQITLWQRPFVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIVGGIGGFMKVRQYD
QILVEICGHKAIGSVLIGPTPVNIVGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005