<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8380 CA21109 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 261
2 3TC+AZT+IDV 321

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y       K20R, K43Q, E44D, V118I, K122E, G196E, E203D, H208F, R211K, K238KR, Q278H, I293V L303P
>CA21109| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIDELRQFLWKWGFYTPDKKHQKEPPFLWMGYELHPDRWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTEEAE
LEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T L24LI L10I, E35ED, N37C, K45R, G51GA, I62V, L63X, I64IV, A71AV, I72V, T74TS, V77I, I85IV, I93IL  
>CA21327| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEDMCLPGRWKPRIIGGIAGFIKVRQYD
QVXVEICGHKVVGSVLIGPTPTNIVGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009