<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8369 CA21096 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 74
2 DDC 78
3 3TC+AZT 35
4 3TC+AZT+IDV 232

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184V D67G, K219Q     K20R, A33G, V118I, K122E, I135T, Q197P, T200A, F214L, T286P, I293V, E297A  
>CA21096| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKGLVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGPHRAKIEELRQHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGPKALTEVVPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M G73T L10I, T12P, L19V, K45R, I62V, L63P, C67L, H69Q  
>CA21314| codons 1-99
PQITLWQRPIVPIKIGGQVKEALLDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVRQYD
QVPIEILGQKAITTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012