<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5149 CA21090 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 217
2 AZT+DDC 39
3 3TC+AZT 17
4 3TC+DDC 47
5 3TC+AZT+IDV 56
6 D4T+DDI+NFV+SQV 35
7 D4T+DDI+RTV+SQV 34
8 3TC+ABC+EFV 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y     F227L T39A, K43Q, E44D, T58S, A98S, V118I, K122E, D123S, S162C, E203K, R211K, K223Q, L228R, D237DN, I293V V106G
>CA21090| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEQDGKISKIGPENPYNSPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSGTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELRQHLWKWGFYTPDKKHQQEPPLRWMGYELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73GC L10I, Q18R, L19V, K20I, L63P, I64V, I72V, P79D, I93L  
>CA21308| codons 1-99
PQITLWQRPIVTIKIGGRVIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAVCTVLVGDTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005