<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8358 CA21069 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ EFV 105

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y K103N, Y188H   K20R, K101KQ, K122E, I135T, E138G, T200E, E203D, R211K, H221Y, L228R, V245M, K277R, Q278E, T286A, E297K, Q334L, A376T, T386A, T403A, T470N, A554T  
>CA21069| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSTNNGTPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLHVGSDLEIGQHREKIDELRQHLLKWGFTTPDKKYQKEPPFRWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKAPKFKLPIQKETWEAWWAEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLNDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18E, E35D, N37S, I62V, L63P, I64V  
>CA21286| codons 14-99
KIGGELKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYDQVPVEICGHKAIG
TVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012