<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6462 CA21068 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 104
2 3TC+AZT 26
3 3TC+D4T 204
4 ABC+DDI+NVP 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, M184V K219Q, N348I K103N, Y181C   T69X, K101R, K102Q, K122E, D123N, I135L, I142T, K166R, V179VI, Q207H, R211K, L228LH, K238KE, A272PT, V276VI, Q278H, T286A, P345A, G359S, K366R, A371V, A376V, K390R, A400T, T403S, D460N, S468T, T470N, H483Y, L491S, K512R, S519N, V531I, K550R, A554T, K558R  
>CA21068| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSXRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLRQNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIII
CQYVDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDQKHQKEPPFHWMGYELHPDEWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKHLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEAFKILKTGKYARMRSA
HTNDVRQLTEVVQKIVTESIVIWGKTPKFRLPIQKETWETWWSEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLNDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDRLVSTGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19IM, P39PS, I62V, L63P, V77I, I93L  
>CA21285| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLSGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005