<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2190 CA21055 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 3TC+D4T 35
3 3TC+D4T+IDV 44
4 None 44
5 3TC+D4T+NFV 8
6 D4T+EFV+RTV+SQV 109

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R K219Q K103N P225H K102R, V118I, F214L, L228R, P243H, V245EK  
>CA21055| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEHPFRWMGYELHPDKWT
VQHIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L23LI L10I, F53Y, L63P, I72V, V77I, L89T, I93L  
>CA21274| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMNLPGRWKPKIIGGIGGYIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNTMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005