<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-3453 CB-3453 Italy 1997 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20I, M36I, R41K, K43R, I64M, H69K, L89M  
>CB-3453| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV       V35T, E36D, T39LS, D121DY, D123E, S162A, K173T, Q174K, D177E, G196GE, Q197L, T200A, Q207E, V245MT, E248ED, T286A, E291D, V292I, I293V, P294T H96L, P97PL
>CB-3453| codons 1-310
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICSEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPLLAGLKKKKSVTVLDVGDAYFSVPL
YKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIELHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREIL

References
Author Title Citation
Balotta, C Increasing prevalence of non-clade B HIV-1 strains heterosexuals, as monitored by the analysis of the RT and protease sequences. JAIDS, 2001