<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-3280 CB-3280 Italy 1998 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20I, E35Q, M36I, N37D, R41K, R57K, I64M, H69K, L89M  
>CB-3280| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, V106I, D121H, K122E, D123S, S162C, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248D, D250E, S251N, A272P, K277R, T286A, E291D, V292I, E297A Q161K
>CB-3280| codons 1-310
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFKCSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKENWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIIPLTAEAE
LELAENREIL

References
Author Title Citation
Balotta, C Increasing prevalence of non-clade B HIV-1 strains heterosexuals, as monitored by the analysis of the RT and protease sequences. JAIDS, 2001