<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-2045 CB-2045 Italy 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14GR, E35D, M36I, R41K, R57K, E65D, H69K, L89M  
>CB-2045| codons 1-99
PQITLWQRPVVTVGIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIDICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, T39A, E40D, V60I, K122E, D123S, I135T, K173L, Q174K, D177G, V179I, T200I, Q207A, R211S, V245Q, E248D, D250E, K281R, T286A, E291D, V292I, I293V, P294T, E297K  
>CB-2045| codons 1-310
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPGIII
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTKEAE
LELAENREIL

References
Author Title Citation
Balotta, C Increasing prevalence of non-clade B HIV-1 strains heterosexuals, as monitored by the analysis of the RT and protease sequences. JAIDS, 2001