<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-1142 CB-1142 Italy 1998 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G17E, K20R, E35D, M36I, R41K, R57K, Q61N, L63T, E65D, L89M  
>CB-1142| codons 1-99
PQITLWQRPLVTIKVGEQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NITIDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, I135V, I142T, S162C, E169D, K173A, Q174R, Q207D, R211K, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, E297A  
>CB-1142| codons 1-310
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGTRYQYNVLPQGWKGSPAIFQCSMTKILDPFRARNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREIL

References
Author Title Citation
Balotta, C Increasing prevalence of non-clade B HIV-1 strains heterosexuals, as monitored by the analysis of the RT and protease sequences. JAIDS, 2001