<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MT-X501 MT-X501 Spain 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6N, K11T, V35T, E36A, T39K, K43E, D123E, I135T, S162Y, F171Y, K173S, D177E, V179I, Q207A, F214L  
>MT-X501| codons 1-242
PISPINTVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPYRSQNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, E35D, M36I, R41K, H69Q, L89M  
>MT-X501| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Thomson, MM HIV-1 genetic diversity in Galicia Spain: BG intersubtype recombinant viruses circulating among injecting drug users. AIDS, 2001