<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MT-X398 MT-X398 Spain 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ 3TC+ AZT NA
2 DDI+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3V, L10I, I13V, L19P, K20I, E35G, M36I, N37S, R41K, H69K, L89M  
>MT-X398| codons 1-99
PQVTLWQRPIVTVKIGGQPIEALLDTGADDTVLEGISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        M16V, E28K, K32E, V35T, E36D, S68G, K122E, D123N, I135A, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, F214L, D237E  
>MT-X398| codons 1-242
PISPIETVPVKLKPGVDGPKVKQWPLTKEKIEALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSANNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPEKWT
VQ

References
Author Title Citation
Thomson, MM HIV-1 genetic diversity in Galicia Spain: BG intersubtype recombinant viruses circulating among injecting drug users. AIDS, 2001