<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MT-X397 MT-X397 Spain 1999 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ D4T NA
2 IDV+ 3TC+ AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   E28K, V35T, E36D, K43R, V60I, A98S, K122E, D123S, I135T, S162A, K173R, Q174K, D177E, T200A, Q207K, R211S  
>MT-X397| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALTDICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRRKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>MT-X397| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Thomson, MM HIV-1 genetic diversity in Galicia Spain: BG intersubtype recombinant viruses circulating among injecting drug users. AIDS, 2001
Perez-Alvarez, L HIV-1 subtype G and BG recombinant viruses in Spanish natives: Evidence of characteristic mutations in reverse transcriptase and protease. AIDS, 2001