<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MT-X230 MT-X230 Spain 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDC+ AZT NA
3 DDI+ DDC+ AZT NA
4 IDV+ 3TC+ AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67A     K20R, V35T, E36D, T39S, T69S, D123E, S162A, K173T, Q174K, D177E, T200A, R211K P9K
>MT-X230| codons 1-242
PISPIETVKVKLKPGMDGPRVKQWPLTEEKIKALTDICSEMEKEGKISKIGPENPYNTPV
FAIKKKASSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V   I13V, K14R, K20I, M36I, N37D, R41K, I66F, H69K, L89M  
>MT-X230| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEFCGKKAIGTVLVGPTPVNVIGRNMLTQIGCTLNF

References
Author Title Citation
Thomson, MM HIV-1 genetic diversity in Galicia Spain: BG intersubtype recombinant viruses circulating among injecting drug users. AIDS, 2001