<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI+NFV NA
2 NRTI+LPV 71

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, L90M N88G L10I, I13V, G16A, Q18H, N37D, Q61H, I62V, L63P, A71L, I72T, V77I, I93L  
>SB-PtC-w71| codons 1-99
PQITLWQRPIVTVKIAGHLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYD
HVPIEICGHKLTGTVVIGPTPANIIGRGLMTQLGCTLNF

References
Author Title Citation
Brun, S Patterns of protease inhibitor cross resistance in viral isolates with reduced susceptibility to lopinavir. CROI 2001, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005